Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Myosin binding protein C, fast-type [141057] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141058] (1 PDB entry) Uniprot Q5XKE0 731-828 |
Domain d1x5ya1: 1x5y A:8-105 [121725] Other proteins in same PDB: d1x5ya2, d1x5ya3 |
PDB Entry: 1x5y (more details)
SCOPe Domain Sequences for d1x5ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} ptsapqhltvedvtdttttlkwrppdrigaggidgylveyclegseewvpankepvercg ftvkdlptgarilfrvvgvniagrsepatllqpvtire
Timeline for d1x5ya1: