![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Splicing factor 3B subunit 4 [143318] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143319] (2 PDB entries) Uniprot Q15427 102-184! Uniprot Q15427 4-96 |
![]() | Domain d1x5ta1: 1x5t A:8-90 [121720] Other proteins in same PDB: d1x5ta2, d1x5ta3 2nd RBD |
PDB Entry: 1x5t (more details)
SCOPe Domain Sequences for d1x5ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} ifignldpeidekllydtfsafgvilqtpkimrdpdtgnskgyafinfasfdasdaaiea mngqylcnrpitvsyafkkdskg
Timeline for d1x5ta1: