Lineage for d1x5sa1 (1x5s A:8-96)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195082Protein Cold-inducible RNA-binding protein [143300] (1 species)
  7. 2195083Species Human (Homo sapiens) [TaxId:9606] [143301] (1 PDB entry)
    Uniprot Q14011 1-90
  8. 2195084Domain d1x5sa1: 1x5s A:8-96 [121719]
    Other proteins in same PDB: d1x5sa2, d1x5sa3

Details for d1x5sa1

PDB Entry: 1x5s (more details)

PDB Description: solution structure of rrm domain in a18 hnrnp
PDB Compounds: (A:) Cold-inducible RNA-binding protein

SCOPe Domain Sequences for d1x5sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5sa1 d.58.7.1 (A:8-96) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}
masdegklfvgglsfdtneqsleqvfskygqisevvvvkdretqrsrgfgfvtfenidda
kdammamngksvdgrqirvdqagkssdnr

SCOPe Domain Coordinates for d1x5sa1:

Click to download the PDB-style file with coordinates for d1x5sa1.
(The format of our PDB-style files is described here.)

Timeline for d1x5sa1: