Lineage for d1x5sa1 (1x5s A:8-97)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415602Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1415603Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1415634Protein Cold-inducible RNA-binding protein [143300] (1 species)
  7. 1415635Species Human (Homo sapiens) [TaxId:9606] [143301] (1 PDB entry)
    Uniprot Q14011 1-90
  8. 1415636Domain d1x5sa1: 1x5s A:8-97 [121719]

Details for d1x5sa1

PDB Entry: 1x5s (more details)

PDB Description: solution structure of rrm domain in a18 hnrnp
PDB Compounds: (A:) Cold-inducible RNA-binding protein

SCOPe Domain Sequences for d1x5sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}
masdegklfvgglsfdtneqsleqvfskygqisevvvvkdretqrsrgfgfvtfenidda
kdammamngksvdgrqirvdqagkssdnrs

SCOPe Domain Coordinates for d1x5sa1:

Click to download the PDB-style file with coordinates for d1x5sa1.
(The format of our PDB-style files is described here.)

Timeline for d1x5sa1: