SCOPe 2.07: Domain d1x5pa1: 1x5p A:8-91

Lineage for d1x5pa1 (1x5p A:8-91)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Negative elongation factor E, NELF-E [143302] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143303] (3 PDB entries)
   Uniprot P18615 257-335! Uniprot P18615 258-341

8. Domain d1x5pa1: 1x5p A:8-91 [121716]
   Other proteins in same PDB: d1x5pa2, d1x5pa3

Details for d1x5pa1

PDB Entry: 1x5p

PDB Description: solution structure of rrm domain in parp14

PDB Compounds: (A:) negative elongation factor e

SCOPe Domain Sequences for d1x5pa1:

Sequence; same for both SEQRES and ATOM records:

>d1x5pa1 d.58.7.1 (A:8-91) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}
erraprkgntlyvygedmtptllrgafspfgniidlsmdpprncafvtyekmesadqava
elngtqvesvqlkvniarkqpmld

Timeline for d1x5pa1:

• d1x5pa1 first appeared in SCOP 1.73
  
• d1x5pa1 appears in SCOPe 2.06
  
• d1x5pa1 appears in the current release, SCOPe 2.08