Lineage for d1x5oa1 (1x5o A:8-108)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952119Protein RNA-binding motif, single-stranded-interacting protein 1, RBMS1 [143356] (1 species)
  7. 2952120Species Human (Homo sapiens) [TaxId:9606] [143357] (1 PDB entry)
    Uniprot P29558 123-223
  8. 2952121Domain d1x5oa1: 1x5o A:8-108 [121715]
    Other proteins in same PDB: d1x5oa2, d1x5oa3

Details for d1x5oa1

PDB Entry: 1x5o (more details)

PDB Description: solution structure of rrm domain in rna binding motif, single-stranded interacting protein 1
PDB Compounds: (A:) RNA binding motif, single-stranded interacting protein 1

SCOPe Domain Sequences for d1x5oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}
lkasgvqaqmakqqeqdptnlyisnlplsmdeqelenmlkpfgqvistrilrdssgtsrg
vgfarmestekceavighfngkfiktppgvsaptepllckf

SCOPe Domain Coordinates for d1x5oa1:

Click to download the PDB-style file with coordinates for d1x5oa1.
(The format of our PDB-style files is described here.)

Timeline for d1x5oa1: