Lineage for d1x5na1 (1x5n A:8-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785956Protein Harmonin [110182] (2 species)
  7. 2785957Species Human (Homo sapiens) [TaxId:9606] [141263] (1 PDB entry)
    Uniprot Q9Y6N9 201-301
  8. 2785958Domain d1x5na1: 1x5n A:8-108 [121714]
    Other proteins in same PDB: d1x5na2, d1x5na3

Details for d1x5na1

PDB Entry: 1x5n (more details)

PDB Description: solution structure of the second pdz domain of harmonin protein
PDB Compounds: (A:) Harmonin

SCOPe Domain Sequences for d1x5na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]}
spgnrenkekkvfislvgsrglgcsissgpiqkpgifishvkpgslsaevgleigdqive
vngvdfsnldhkeavnvlkssrsltisivaaagrelfmtdr

SCOPe Domain Coordinates for d1x5na1:

Click to download the PDB-style file with coordinates for d1x5na1.
(The format of our PDB-style files is described here.)

Timeline for d1x5na1: