SCOP 1.73: Domain d1x5ka1: 1x5k A:8-118

Lineage for d1x5ka1 (1x5k A:8-118)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Neogenin [141053] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141054] (6 PDB entries)

8. Domain d1x5ka1: 1x5k A:8-118 [121712]

Details for d1x5ka1

PDB Entry: 1x5k

PDB Description: the solution structure of the sixth fibronectin type iii domain of human neogenin

PDB Compounds: (A:) Neogenin

SCOP Domain Sequences for d1x5ka1:

Sequence; same for both SEQRES and ATOM records:

>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]}
tahgttfelvptsppkdvtvvskegkpktiivnwqppseangkitgyiiyystdvnaeih
dwviepvvgnrlthqiqeltldtpyyfkiqarnskgmgpmseavqfrtpka

Timeline for d1x5ka1:

• d1x5ka1 is new in SCOP 1.73
  
• d1x5ka1 appears in SCOP 1.75
  
• d1x5ka1 appears in the current release, SCOPe 2.08