Lineage for d1x5ia1 (1x5i A:8-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2372068Protein Neogenin [141053] (1 species)
  7. 2372069Species Human (Homo sapiens) [TaxId:9606] [141054] (6 PDB entries)
    Uniprot Q92859 429-535! Uniprot Q92859 529-631! Uniprot Q92859 623-741! Uniprot Q92859 718-830! Uniprot Q92859 853-952! Uniprot Q92859 942-1054
  8. 2372074Domain d1x5ia1: 1x5i A:8-120 [121710]
    Other proteins in same PDB: d1x5ia2, d1x5ia3

Details for d1x5ia1

PDB Entry: 1x5i (more details)

PDB Description: the solution structure of the fourth fibronectin type iii domain of human neogenin
PDB Compounds: (A:) Neogenin

SCOPe Domain Sequences for d1x5ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]}
patdwlsaetfesdldetrvpevpsslhvrplvtsivvswtppenqnivvrgyaigygig
sphaqtikvdykqryytienldpsshyvitlkafnnvgegiplyesavtrpht

SCOPe Domain Coordinates for d1x5ia1:

Click to download the PDB-style file with coordinates for d1x5ia1.
(The format of our PDB-style files is described here.)

Timeline for d1x5ia1: