Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (44 proteins) Pfam PF00041 |
Protein Neogenin [141053] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141054] (6 PDB entries) Uniprot Q92859 429-535! Uniprot Q92859 529-631! Uniprot Q92859 623-741! Uniprot Q92859 718-830! Uniprot Q92859 853-952! Uniprot Q92859 942-1054 |
Domain d1x5ia1: 1x5i A:8-120 [121710] |
PDB Entry: 1x5i (more details)
SCOP Domain Sequences for d1x5ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} patdwlsaetfesdldetrvpevpsslhvrplvtsivvswtppenqnivvrgyaigygig sphaqtikvdykqryytienldpsshyvitlkafnnvgegiplyesavtrpht
Timeline for d1x5ia1: