Lineage for d1x5ia1 (1x5i A:8-120)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657522Protein Neogenin [141053] (1 species)
  7. 657523Species Human (Homo sapiens) [TaxId:9606] [141054] (6 PDB entries)
  8. 657527Domain d1x5ia1: 1x5i A:8-120 [121710]

Details for d1x5ia1

PDB Entry: 1x5i (more details)

PDB Description: The solution structure of the fourth fibronectin type III domain of human Neogenin
PDB Compounds: (A:) Neogenin

SCOP Domain Sequences for d1x5ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]}
patdwlsaetfesdldetrvpevpsslhvrplvtsivvswtppenqnivvrgyaigygig
sphaqtikvdykqryytienldpsshyvitlkafnnvgegiplyesavtrpht

SCOP Domain Coordinates for d1x5ia1:

Click to download the PDB-style file with coordinates for d1x5ia1.
(The format of our PDB-style files is described here.)

Timeline for d1x5ia1: