Lineage for d1x5aa1 (1x5a A:8-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761749Protein Ephrin type-A receptor 1 [141063] (1 species)
  7. 2761750Species Mouse (Mus musculus) [TaxId:10090] [141064] (1 PDB entry)
    Uniprot Q60750 446-539
  8. 2761751Domain d1x5aa1: 1x5a A:8-101 [121706]
    Other proteins in same PDB: d1x5aa2, d1x5aa3

Details for d1x5aa1

PDB Entry: 1x5a (more details)

PDB Description: the solution structure of the second fibronectin type iii domain of mouse ephrin type-a receptor 1
PDB Compounds: (A:) Ephrin type-A receptor 1

SCOPe Domain Sequences for d1x5aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]}
aeslsglslklvkkeprqleltwagsrprnpggnlsyelhvlnqdeewhqmvleprvllt
klqpdttyivrvrtltplgpgpfspdhefrtspp

SCOPe Domain Coordinates for d1x5aa1:

Click to download the PDB-style file with coordinates for d1x5aa1.
(The format of our PDB-style files is described here.)

Timeline for d1x5aa1: