Class a: All alpha proteins [46456] (289 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.12: EDF1-like [140529] (1 protein) part of Pfam PF01381 |
Protein Endothelial differentiation-related factor 1, EDF1 [140530] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140531] (1 PDB entry) Uniprot O60869 71-148 |
Domain d1x57a1: 1x57 A:8-85 [121704] Other proteins in same PDB: d1x57a2, d1x57a3 |
PDB Entry: 1x57 (more details)
SCOPe Domain Sequences for d1x57a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} drvtlevgkviqqgrqskgltqkdlatkinekpqviadyesgraipnnqvlgkieraigl klrgkdigkpiekgprak
Timeline for d1x57a1: