SCOPe 2.07: Domain d1x57a1: 1x57 A:8-85

Lineage for d1x57a1 (1x57 A:8-85)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.12: EDF1-like [140529] (1 protein)
   part of Pfam PF01381

6. Protein Endothelial differentiation-related factor 1, EDF1 [140530] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140531] (1 PDB entry)
   Uniprot O60869 71-148

8. Domain d1x57a1: 1x57 A:8-85 [121704]
   Other proteins in same PDB: d1x57a2, d1x57a3

Details for d1x57a1

PDB Entry: 1x57

PDB Description: solution structures of the hth domain of human edf-1 protein

PDB Compounds: (A:) Endothelial differentiation-related factor 1

SCOPe Domain Sequences for d1x57a1:

Sequence; same for both SEQRES and ATOM records:

>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]}
drvtlevgkviqqgrqskgltqkdlatkinekpqviadyesgraipnnqvlgkieraigl
klrgkdigkpiekgprak

Timeline for d1x57a1:

• d1x57a1 first appeared in SCOP 1.73
  
• d1x57a1 appears in SCOPe 2.06
  
• d1x57a1 appears in the current release, SCOPe 2.08