![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.5: AHSA1 domain [111168] (12 proteins) Pfam PF05146 |
![]() | Protein Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 [143833] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143834] (1 PDB entry) Uniprot O95433 204-335 |
![]() | Domain d1x53a1: 1x53 A:8-139 [121703] Other proteins in same PDB: d1x53a2, d1x53a3 |
PDB Entry: 1x53 (more details)
SCOPe Domain Sequences for d1x53a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x53a1 d.129.3.5 (A:8-139) Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 {Human (Homo sapiens) [TaxId: 9606]} iptckitlketfltspeelyrvfttqelvqafthapatleadrggkfhmvdgnvsgeftd lvpekhivmkwrfkswpeghfatitltfidkngetelcmegrgipapeeertrqgwqryy fegikqtfgyga
Timeline for d1x53a1: