SCOPe 2.08: Domain d1x53a1: 1x53 A:8-139

Lineage for d1x53a1 (1x53 A:8-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
   Pfam PF05146

6. Protein Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 [143833] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143834] (1 PDB entry)
   Uniprot O95433 204-335

8. Domain d1x53a1: 1x53 A:8-139 [121703]
   Other proteins in same PDB: d1x53a2, d1x53a3

Details for d1x53a1

PDB Entry: 1x53

PDB Description: the solution structure of the c-terminal domain of human activator of 90 kda heat shock protein atpase homolog 1

PDB Compounds: (A:) Activator of 90 kDa heat shock protein ATPase homolog 1

SCOPe Domain Sequences for d1x53a1:

Sequence; same for both SEQRES and ATOM records:

>d1x53a1 d.129.3.5 (A:8-139) Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 {Human (Homo sapiens) [TaxId: 9606]}
iptckitlketfltspeelyrvfttqelvqafthapatleadrggkfhmvdgnvsgeftd
lvpekhivmkwrfkswpeghfatitltfidkngetelcmegrgipapeeertrqgwqryy
fegikqtfgyga

Timeline for d1x53a1:

• d1x53a1 first appeared in SCOP 1.73
  
• d1x53a1 appears in SCOPe 2.07