Lineage for d1x51a1 (1x51 A:8-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971722Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins)
  6. 2971723Protein A/G-specific adenine DNA glycosylase [143768] (1 species)
    MutY homolog
  7. 2971724Species Human (Homo sapiens) [TaxId:9606] [143769] (1 PDB entry)
    Uniprot Q9UIF7 356-497
  8. 2971725Domain d1x51a1: 1x51 A:8-149 [121702]
    Other proteins in same PDB: d1x51a2, d1x51a3

Details for d1x51a1

PDB Entry: 1x51 (more details)

PDB Description: solution structure of the nudix domain from human a/g-specific adenine dna glycosylase alpha-3 splice isoform
PDB Compounds: (A:) A/G-specific adenine DNA glycosylase

SCOPe Domain Sequences for d1x51a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
prkasrkppreessatcvleqpgalgaqillvqrpnsgllaglwefpsvtwepseqlqrk
allqelqrwagplpathlrhlgevvhtfshikltyqvyglalegqtpvttvppgarwltq
eefhtaavstamkkvfrvyqgq

SCOPe Domain Coordinates for d1x51a1:

Click to download the PDB-style file with coordinates for d1x51a1.
(The format of our PDB-style files is described here.)

Timeline for d1x51a1: