![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins) |
![]() | Protein A/G-specific adenine DNA glycosylase [143768] (1 species) MutY homolog |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143769] (1 PDB entry) Uniprot Q9UIF7 356-497 |
![]() | Domain d1x51a1: 1x51 A:8-149 [121702] Other proteins in same PDB: d1x51a2, d1x51a3 |
PDB Entry: 1x51 (more details)
SCOPe Domain Sequences for d1x51a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} prkasrkppreessatcvleqpgalgaqillvqrpnsgllaglwefpsvtwepseqlqrk allqelqrwagplpathlrhlgevvhtfshikltyqvyglalegqtpvttvppgarwltq eefhtaavstamkkvfrvyqgq
Timeline for d1x51a1: