SCOPe 2.08: Domain d1x51a1: 1x51 A:8-149

Lineage for d1x51a1 (1x51 A:8-149)

1. Root: SCOPe 2.08
2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif
4. Superfamily d.113.1: Nudix [55811] (8 families)
5. Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins)
6. Protein A/G-specific adenine DNA glycosylase [143768] (1 species)
   MutY homolog
7. Species Human (Homo sapiens) [TaxId:9606] [143769] (1 PDB entry)
   Uniprot Q9UIF7 356-497
8. Domain d1x51a1: 1x51 A:8-149 [121702]
   Other proteins in same PDB: d1x51a2, d1x51a3

Details for d1x51a1

PDB Entry: 1x51

PDB Description: Solution structure of the NUDIX domain from human A/G-specific adenine DNA glycosylase alpha-3 splice isoform

PDB Compounds: (A:) A/G-specific adenine DNA glycosylase

SCOPe Domain Sequences for d1x51a1:

Sequence; same for both SEQRES and ATOM records:

>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
prkasrkppreessatcvleqpgalgaqillvqrpnsgllaglwefpsvtwepseqlqrk
allqelqrwagplpathlrhlgevvhtfshikltyqvyglalegqtpvttvppgarwltq
eefhtaavstamkkvfrvyqgq

SCOPe Domain Coordinates for d1x51a1 are not available.

Timeline for d1x51a1:

• d1x51a1 first appeared in SCOP 1.73
  
• d1x51a1 appears in SCOPe 2.07