Lineage for d1x4za1 (1x4z A:8-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761683Protein Brother of CDO precursor (BOC) [141037] (1 species)
  7. 2761684Species Mouse (Mus musculus) [TaxId:10090] [141038] (2 PDB entries)
    Uniprot Q6AZB0 591-689! Uniprot Q6AZB0 707-807
  8. 2761685Domain d1x4za1: 1x4z A:8-115 [121701]
    Other proteins in same PDB: d1x4za2, d1x4za3

Details for d1x4za1

PDB Entry: 1x4z (more details)

PDB Description: solution structure of the 2nd fibronectin type iii domain from mouse biregional cell adhesion molecule-related/down-regulated oncogenes (cdon) binding protein
PDB Compounds: (A:) biregional cell adhesion molecule-related/down-regulated oncogenes (Cdon)binding protein

SCOPe Domain Sequences for d1x4za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}
sqpdhgrlsppeapdrptistasetsvyvtwiprgnggfpiqsfrveykklkkvgdwila
tsaippsrlsveitglekgisykfrvralnmlgesepsapsrpyvvsg

SCOPe Domain Coordinates for d1x4za1:

Click to download the PDB-style file with coordinates for d1x4za1.
(The format of our PDB-style files is described here.)

Timeline for d1x4za1: