Lineage for d1x4xa1 (1x4x A:8-100)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767710Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species)
  7. 1767711Species Human (Homo sapiens) [TaxId:9606] [117058] (6 PDB entries)
    Uniprot Q9Y2H6 192-315
  8. 1767714Domain d1x4xa1: 1x4x A:8-100 [121699]

Details for d1x4xa1

PDB Entry: 1x4x (more details)

PDB Description: solution structure of the 6th fibronectin type iii domain from human fibronectin type iii domain containing protein 3
PDB Compounds: (A:) Fibronectin type-III domain containing protein 3a

SCOPe Domain Sequences for d1x4xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}
pdqckppqvtcrsatcaqvnwevplsngtdvteyrlewggvegsmqicycgpglsyeikg
lspattyycrvqalsvvgagpfsevvacvtpps

SCOPe Domain Coordinates for d1x4xa1:

Click to download the PDB-style file with coordinates for d1x4xa1.
(The format of our PDB-style files is described here.)

Timeline for d1x4xa1: