Lineage for d1x4ta1 (1x4t A:7-86)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633762Superfamily a.2.15: ISY1 domain-like [140102] (1 family) (S)
  5. 633763Family a.2.15.1: ISY1 N-terminal domain-like [140103] (1 protein)
    N-terminal region of Pfam PF06246
  6. 633764Protein Pre-mRNA-splicing factor ISY1 homolog [140104] (1 species)
  7. 633765Species Mouse (Mus musculus) [TaxId:10090] [140105] (1 PDB entry)
  8. 633766Domain d1x4ta1: 1x4t A:7-86 [121698]

Details for d1x4ta1

PDB Entry: 1x4t (more details)

PDB Description: solution structure of isy1 domain in hypothetical protein
PDB Compounds: (A:) hypothetical protein LOC57905

SCOP Domain Sequences for d1x4ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4ta1 a.2.15.1 (A:7-86) Pre-mRNA-splicing factor ISY1 homolog {Mouse (Mus musculus) [TaxId: 10090]}
gkvkerrpflasectelpkaekwrrqiigeiskkvaqiqnaglgefrirdlndeinkllr
ekghwevrikelggpdygkv

SCOP Domain Coordinates for d1x4ta1:

Click to download the PDB-style file with coordinates for d1x4ta1.
(The format of our PDB-style files is described here.)

Timeline for d1x4ta1: