Lineage for d1x4ta1 (1x4t A:8-86)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980284Superfamily a.2.15: ISY1 domain-like [140102] (1 family) (S)
    automatically mapped to Pfam PF06246
  5. 1980285Family a.2.15.1: ISY1 N-terminal domain-like [140103] (1 protein)
    N-terminal region of Pfam PF06246
  6. 1980286Protein Pre-mRNA-splicing factor ISY1 homolog [140104] (1 species)
  7. 1980287Species Mouse (Mus musculus) [TaxId:10090] [140105] (1 PDB entry)
    Uniprot Q69ZQ2 23-102
  8. 1980288Domain d1x4ta1: 1x4t A:8-86 [121698]
    Other proteins in same PDB: d1x4ta2, d1x4ta3

Details for d1x4ta1

PDB Entry: 1x4t (more details)

PDB Description: Solution structure of Isy1 domain in hypothetical protein
PDB Compounds: (A:) hypothetical protein LOC57905

SCOPe Domain Sequences for d1x4ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4ta1 a.2.15.1 (A:8-86) Pre-mRNA-splicing factor ISY1 homolog {Mouse (Mus musculus) [TaxId: 10090]}
kvkerrpflasectelpkaekwrrqiigeiskkvaqiqnaglgefrirdlndeinkllre
kghwevrikelggpdygkv

SCOPe Domain Coordinates for d1x4ta1:

Click to download the PDB-style file with coordinates for d1x4ta1.
(The format of our PDB-style files is described here.)

Timeline for d1x4ta1: