Lineage for d1x4sa1 (1x4s A:8-53)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038778Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888)
  4. 3038779Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) (S)
  5. 3038797Family g.85.1.2: HIT zinc finger [144240] (1 protein)
    Pfam PF04438
  6. 3038798Protein Zinc finger HIT domain containing protein 2, ZNHIT2 [144241] (1 species)
    aka FON protein
  7. 3038799Species Human (Homo sapiens) [TaxId:9606] [144242] (1 PDB entry)
    Uniprot Q9UHR6 1-46
  8. 3038800Domain d1x4sa1: 1x4s A:8-53 [121697]
    Other proteins in same PDB: d1x4sa2, d1x4sa3
    complexed with zn

Details for d1x4sa1

PDB Entry: 1x4s (more details)

PDB Description: solution structure of zinc finger hit domain in protein fon
PDB Compounds: (A:) Zinc finger HIT domain containing protein 2

SCOPe Domain Sequences for d1x4sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4sa1 g.85.1.2 (A:8-53) Zinc finger HIT domain containing protein 2, ZNHIT2 {Human (Homo sapiens) [TaxId: 9606]}
mepagpcgfcpagevqparytcprcnapycslrcyrthgtcaenfy

SCOPe Domain Coordinates for d1x4sa1:

Click to download the PDB-style file with coordinates for d1x4sa1.
(The format of our PDB-style files is described here.)

Timeline for d1x4sa1: