Class g: Small proteins [56992] (100 folds) |
Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily) dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888) |
Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) |
Family g.85.1.2: HIT zinc finger [144240] (1 protein) Pfam PF04438 |
Protein Zinc finger HIT domain containing protein 2, ZNHIT2 [144241] (1 species) aka FON protein |
Species Human (Homo sapiens) [TaxId:9606] [144242] (1 PDB entry) Uniprot Q9UHR6 1-46 |
Domain d1x4sa1: 1x4s A:8-53 [121697] Other proteins in same PDB: d1x4sa2, d1x4sa3 complexed with zn |
PDB Entry: 1x4s (more details)
SCOPe Domain Sequences for d1x4sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4sa1 g.85.1.2 (A:8-53) Zinc finger HIT domain containing protein 2, ZNHIT2 {Human (Homo sapiens) [TaxId: 9606]} mepagpcgfcpagevqparytcprcnapycslrcyrthgtcaenfy
Timeline for d1x4sa1: