Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins) an RNA-binding domain |
Protein Far upstream binding element, FBP [75418] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [143219] (2 PDB entries) Uniprot Q91WJ8 175-255! Uniprot Q91WJ8 89-168 |
Domain d1x4na1: 1x4n A:8-86 [121696] 1st KH domain |
PDB Entry: 1x4n (more details)
SCOPe Domain Sequences for d1x4na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} hqqqrsvmteeykvpdgmvgfiigrggeqisriqqesgckiqiapdsgglperscmltgt pesvqsakrlldqivekgr
Timeline for d1x4na1: