Lineage for d1x4ma1 (1x4m A:8-88)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947100Protein Far upstream binding element, FBP [75418] (2 species)
  7. 2947104Species Mouse (Mus musculus) [TaxId:10090] [143219] (2 PDB entries)
    Uniprot Q91WJ8 175-255! Uniprot Q91WJ8 89-168
  8. 2947105Domain d1x4ma1: 1x4m A:8-88 [121695]
    Other proteins in same PDB: d1x4ma2, d1x4ma3
    2nd KH domain

Details for d1x4ma1

PDB Entry: 1x4m (more details)

PDB Description: solution structure of kh domain in far upstream element binding protein 1
PDB Compounds: (A:) Far upstream element binding protein 1

SCOPe Domain Sequences for d1x4ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]}
hgdgpgnavqeimipaskaglvigkggetikqlqeragvkmvmiqdgpqntgadkplrit
gdpykvqqakemvlelirdqg

SCOPe Domain Coordinates for d1x4ma1:

Click to download the PDB-style file with coordinates for d1x4ma1.
(The format of our PDB-style files is described here.)

Timeline for d1x4ma1: