Lineage for d1x4ka1 (1x4k A:35-66)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035797Protein Four and a half LIM domains protein 2, FHL2 [144161] (1 species)
    Skeletal muscle lim-protein 3
  7. 3035798Species Human (Homo sapiens) [TaxId:9606] [144162] (3 PDB entries)
    Uniprot Q14192 128-159! Uniprot Q14192 162-186! Uniprot Q14192 187-218! Uniprot Q14192 221-249! Uniprot Q14192 250-279! Uniprot Q14192 98-127
  8. 3035799Domain d1x4ka1: 1x4k A:35-66 [121691]
    Other proteins in same PDB: d1x4ka3, d1x4ka4
    2nd LIM domain
    complexed with zn

Details for d1x4ka1

PDB Entry: 1x4k (more details)

PDB Description: solution structure of lim domain in lim-protein 3
PDB Compounds: (A:) Skeletal muscle LIM-protein 3

SCOPe Domain Sequences for d1x4ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]}
ichrcqqpigtksfipkdnqnfcvpcyekqha

SCOPe Domain Coordinates for d1x4ka1:

Click to download the PDB-style file with coordinates for d1x4ka1.
(The format of our PDB-style files is described here.)

Timeline for d1x4ka1: