Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein RNA-binding protein 28 [143358] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [143359] (1 PDB entry) Uniprot Q8CGC6 316-413 |
Domain d1x4ha1: 1x4h A:8-105 [121690] Other proteins in same PDB: d1x4ha2, d1x4ha3 |
PDB Entry: 1x4h (more details)
SCOPe Domain Sequences for d1x4ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} lpsdvtegktvfirnlsfdseeealgevlqqfgdlkyvrvvlhpdtehskgcafaqfmtq eaaqkclaaasleaeggglkldgrqlkvdlavtrdeaa
Timeline for d1x4ha1: