Lineage for d1x4ha1 (1x4h A:8-105)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952132Protein RNA-binding protein 28 [143358] (1 species)
  7. 2952133Species Mouse (Mus musculus) [TaxId:10090] [143359] (1 PDB entry)
    Uniprot Q8CGC6 316-413
  8. 2952134Domain d1x4ha1: 1x4h A:8-105 [121690]
    Other proteins in same PDB: d1x4ha2, d1x4ha3

Details for d1x4ha1

PDB Entry: 1x4h (more details)

PDB Description: solution structure of rrm domain in rna-binding protein 28
PDB Compounds: (A:) RNA-binding protein 28

SCOPe Domain Sequences for d1x4ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}
lpsdvtegktvfirnlsfdseeealgevlqqfgdlkyvrvvlhpdtehskgcafaqfmtq
eaaqkclaaasleaeggglkldgrqlkvdlavtrdeaa

SCOPe Domain Coordinates for d1x4ha1:

Click to download the PDB-style file with coordinates for d1x4ha1.
(The format of our PDB-style files is described here.)

Timeline for d1x4ha1: