![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
![]() | Protein Nucleolysin TIAR [143298] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143299] (3 PDB entries) Uniprot Q01085 1-90! Uniprot Q01085 187-282 |
![]() | Domain d1x4ga1: 1x4g A:8-103 [121689] 2nd RBD |
PDB Entry: 1x4g (more details)
SCOPe Domain Sequences for d1x4ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} ntkqlrfedvvnqsspknctvycggiasgltdqlmrqtfspfgqimeirvfpekgysfvr fsthesaahaivsvngttieghvvkcywgkespdmt
Timeline for d1x4ga1: