Lineage for d1x4ca1 (1x4c A:8-102)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908846Protein Splicing factor, arginine/serine-rich 1, SFRS1 [143346] (2 species)
  7. 1908851Species Mouse (Mus musculus) [TaxId:10090] [143348] (1 PDB entry)
    Uniprot Q6PDM2 112-206
  8. 1908852Domain d1x4ca1: 1x4c A:8-102 [121685]

Details for d1x4ca1

PDB Entry: 1x4c (more details)

PDB Description: solution structure of rrm domain in splicing factor 2
PDB Compounds: (A:) Splicing factor, arginine/serine-rich 1

SCOPe Domain Sequences for d1x4ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4ca1 d.58.7.1 (A:8-102) Splicing factor, arginine/serine-rich 1, SFRS1 {Mouse (Mus musculus) [TaxId: 10090]}
gppsrrsenrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrkedmtyav
rkldntkfrshegetayirvkvdgprspsygrsrs

SCOPe Domain Coordinates for d1x4ca1:

Click to download the PDB-style file with coordinates for d1x4ca1.
(The format of our PDB-style files is described here.)

Timeline for d1x4ca1: