![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Splicing factor, arginine/serine-rich 1, SFRS1 [143346] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [143348] (1 PDB entry) Uniprot Q6PDM2 112-206 |
![]() | Domain d1x4ca1: 1x4c A:8-102 [121685] Other proteins in same PDB: d1x4ca2, d1x4ca3 |
PDB Entry: 1x4c (more details)
SCOPe Domain Sequences for d1x4ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4ca1 d.58.7.1 (A:8-102) Splicing factor, arginine/serine-rich 1, SFRS1 {Mouse (Mus musculus) [TaxId: 10090]} gppsrrsenrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrkedmtyav rkldntkfrshegetayirvkvdgprspsygrsrs
Timeline for d1x4ca1: