| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
| Protein Heterogeneous nuclear ribonucleoproteins A2/B1 [143342] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [143343] (1 PDB entry) Uniprot P22626 1-103 |
| Domain d1x4ba1: 1x4b A:8-110 [121684] Other proteins in same PDB: d1x4ba2, d1x4ba3 1st RBD |
PDB Entry: 1x4b (more details)
SCOPe Domain Sequences for d1x4ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}
mektletvplerkkrekeqfrklfigglsfetteeslrnyyeqwgkltdcvvmrdpaskr
srgfgfvtfssmaevdaamaarphsidgrvvepkravareesg
Timeline for d1x4ba1: