Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Splicing factor, arginine/serine-rich 1, SFRS1 [143346] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [143347] (3 PDB entries) Uniprot Q07955 1-95 |
Domain d1x4aa1: 1x4a A:8-103 [121683] Other proteins in same PDB: d1x4aa2, d1x4aa3 1st RBD |
PDB Entry: 1x4a (more details)
SCOPe Domain Sequences for d1x4aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4aa1 d.58.7.1 (A:8-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} msgggvirgpagnndcriyvgnlppdirtkdiedvfykygairdidlknrrggppfafve fedprdaedavygrdgydydgyrlrvefprsgrgtg
Timeline for d1x4aa1: