Lineage for d1x49a1 (1x49 A:8-92)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722458Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 722459Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 722460Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
    Pfam PF00035
  6. 722472Protein dsRNA-dependent protein kinase pkr [54774] (2 species)
    contains tandem repeat of two dsRBD
  7. 722476Species Mouse (Mus musculus) [TaxId:10090] [143201] (2 PDB entries)
  8. 722477Domain d1x49a1: 1x49 A:8-92 [121682]
    1st dsRBD

Details for d1x49a1

PDB Entry: 1x49 (more details)

PDB Description: Solution structure of the first DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
PDB Compounds: (A:) Interferon-induced, double-stranded RNA-activated protein kinase

SCOP Domain Sequences for d1x49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]}
masdtpgfymdklnkyrqmhgvaitykelstsgpphdrrftfqvlidekefpeakgrskq
earnaaaklavdildnenkvdchts

SCOP Domain Coordinates for d1x49a1:

Click to download the PDB-style file with coordinates for d1x49a1.
(The format of our PDB-style files is described here.)

Timeline for d1x49a1: