Lineage for d1x49a1 (1x49 A:8-91)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946841Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2946853Protein dsRNA-dependent protein kinase pkr [54774] (2 species)
    contains tandem repeat of two dsRBD
  7. 2946857Species Mouse (Mus musculus) [TaxId:10090] [143201] (2 PDB entries)
    Uniprot Q03963 1-85! Uniprot Q03963 96-181
  8. 2946858Domain d1x49a1: 1x49 A:8-91 [121682]
    Other proteins in same PDB: d1x49a2, d1x49a3
    1st dsRBD

Details for d1x49a1

PDB Entry: 1x49 (more details)

PDB Description: solution structure of the first dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
PDB Compounds: (A:) Interferon-induced, double-stranded RNA-activated protein kinase

SCOPe Domain Sequences for d1x49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x49a1 d.50.1.1 (A:8-91) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]}
masdtpgfymdklnkyrqmhgvaitykelstsgpphdrrftfqvlidekefpeakgrskq
earnaaaklavdildnenkvdcht

SCOPe Domain Coordinates for d1x49a1:

Click to download the PDB-style file with coordinates for d1x49a1.
(The format of our PDB-style files is described here.)

Timeline for d1x49a1: