Lineage for d1x47a1 (1x47 A:8-92)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722458Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 722459Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 722460Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
    Pfam PF00035
  6. 722465Protein Dgcr8 protein [143206] (1 species)
  7. 722466Species Human (Homo sapiens) [TaxId:9606] [143207] (1 PDB entry)
  8. 722467Domain d1x47a1: 1x47 A:8-92 [121680]

Details for d1x47a1

PDB Entry: 1x47 (more details)

PDB Description: solution structure of dsrm domain in dgcr8 protein
PDB Compounds: (A:) DGCR8 protein

SCOP Domain Sequences for d1x47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]}
efvinpngksevcilheymqrvlkvrpvynffecenpsepfgasvtidgvtygsgtassk
klaknkaaratleilipdfvkqtse

SCOP Domain Coordinates for d1x47a1:

Click to download the PDB-style file with coordinates for d1x47a1.
(The format of our PDB-style files is described here.)

Timeline for d1x47a1: