![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
![]() | Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins) Pfam PF00035 |
![]() | Protein Dgcr8 protein [143206] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143207] (1 PDB entry) Uniprot Q8WYQ5 502-586 |
![]() | Domain d1x47a1: 1x47 A:8-92 [121680] Other proteins in same PDB: d1x47a2, d1x47a3 |
PDB Entry: 1x47 (more details)
SCOPe Domain Sequences for d1x47a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} efvinpngksevcilheymqrvlkvrpvynffecenpsepfgasvtidgvtygsgtassk klaknkaaratleilipdfvkqtse
Timeline for d1x47a1: