Lineage for d1x47a1 (1x47 A:8-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946841Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2946846Protein Dgcr8 protein [143206] (1 species)
  7. 2946847Species Human (Homo sapiens) [TaxId:9606] [143207] (1 PDB entry)
    Uniprot Q8WYQ5 502-586
  8. 2946848Domain d1x47a1: 1x47 A:8-92 [121680]
    Other proteins in same PDB: d1x47a2, d1x47a3

Details for d1x47a1

PDB Entry: 1x47 (more details)

PDB Description: solution structure of dsrm domain in dgcr8 protein
PDB Compounds: (A:) DGCR8 protein

SCOPe Domain Sequences for d1x47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]}
efvinpngksevcilheymqrvlkvrpvynffecenpsepfgasvtidgvtygsgtassk
klaknkaaratleilipdfvkqtse

SCOPe Domain Coordinates for d1x47a1:

Click to download the PDB-style file with coordinates for d1x47a1.
(The format of our PDB-style files is described here.)

Timeline for d1x47a1: