![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Myosin-binding protein C, slow-type [141013] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141014] (2 PDB entries) Uniprot Q00872 342-431! Uniprot Q00872 58-170 |
![]() | Domain d1x44a1: 1x44 A:8-97 [121678] Other proteins in same PDB: d1x44a2, d1x44a3 3rd Iset domain |
PDB Entry: 1x44 (more details)
SCOPe Domain Sequences for d1x44a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} imvtkqledttaycgervelecevseddanvkwfkngeeiipgpksryrirvegkkhili iegatkadaaeysvmttggqssaklsvdlk
Timeline for d1x44a1: