SCOPe 2.07: Domain d1x42a1: 1x42 A:1-230

Lineage for d1x42a1 (1x42 A:1-230)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.1: HAD-related [56785] (3 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein Hypothetical protein PH0459 [142133] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [142134] (1 PDB entry)
   Uniprot O58216 1-230

8. Domain d1x42a1: 1x42 A:1-230 [121677]

Details for d1x42a1

PDB Entry: 1x42, 2 Å

PDB Description: Crystal structure of a haloacid dehalogenase family protein (PH0459) from Pyrococcus horikoshii OT3

PDB Compounds: (A:) hypothetical protein PH0459

SCOPe Domain Sequences for d1x42a1:

Sequence; same for both SEQRES and ATOM records:

>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Pyrococcus horikoshii [TaxId: 53953]}
miravffdfvgtllsvegeakthlkimeevlgdyplnpktlldeyekltreafsnyagkp
yrpirdieeevmrklaekygfkypenfweihlrmhqrygelypevvevlkslkgkyhvgm
itdsdteylmahldalgikdlfdsittseeagffkphprifelalkkagvkgeeavyvgd
npvkdcggsknlgmtsilldrkgekrefwdkcdfivsdlrevikivdeln

Timeline for d1x42a1:

• d1x42a1 first appeared in SCOP 1.73
  
• d1x42a1 appears in SCOPe 2.06
  
• d1x42a1 appears in the current release, SCOPe 2.08