Lineage for d1x42a1 (1x42 A:1-230)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2526733Family c.108.1.1: HAD-related [56785] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2526734Protein Hypothetical protein PH0459 [142133] (1 species)
  7. 2526735Species Pyrococcus horikoshii [TaxId:53953] [142134] (1 PDB entry)
    Uniprot O58216 1-230
  8. 2526736Domain d1x42a1: 1x42 A:1-230 [121677]

Details for d1x42a1

PDB Entry: 1x42 (more details), 2 Å

PDB Description: Crystal structure of a haloacid dehalogenase family protein (PH0459) from Pyrococcus horikoshii OT3
PDB Compounds: (A:) hypothetical protein PH0459

SCOPe Domain Sequences for d1x42a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Pyrococcus horikoshii [TaxId: 53953]}
miravffdfvgtllsvegeakthlkimeevlgdyplnpktlldeyekltreafsnyagkp
yrpirdieeevmrklaekygfkypenfweihlrmhqrygelypevvevlkslkgkyhvgm
itdsdteylmahldalgikdlfdsittseeagffkphprifelalkkagvkgeeavyvgd
npvkdcggsknlgmtsilldrkgekrefwdkcdfivsdlrevikivdeln

SCOPe Domain Coordinates for d1x42a1:

Click to download the PDB-style file with coordinates for d1x42a1.
(The format of our PDB-style files is described here.)

Timeline for d1x42a1: