![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.1: HAD-related [56785] (3 proteins) the insertion subdomain is a 4-helical bundle |
![]() | Protein Hypothetical protein PH0459 [142133] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [142134] (1 PDB entry) Uniprot O58216 1-230 |
![]() | Domain d1x42a1: 1x42 A:1-230 [121677] |
PDB Entry: 1x42 (more details), 2 Å
SCOPe Domain Sequences for d1x42a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Pyrococcus horikoshii [TaxId: 53953]} miravffdfvgtllsvegeakthlkimeevlgdyplnpktlldeyekltreafsnyagkp yrpirdieeevmrklaekygfkypenfweihlrmhqrygelypevvevlkslkgkyhvgm itdsdteylmahldalgikdlfdsittseeagffkphprifelalkkagvkgeeavyvgd npvkdcggsknlgmtsilldrkgekrefwdkcdfivsdlrevikivdeln
Timeline for d1x42a1: