SCOP 1.73: Domain d1x41a1: 1x41 A:8-54

Lineage for d1x41a1 (1x41 A:8-54)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (17 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (39 proteins)
   Pfam PF00046

6. Protein Transcriptional adaptor 2-like, TADA2L, isoform b [140145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140146] (1 PDB entry)

8. Domain d1x41a1: 1x41 A:8-54 [121676]

Details for d1x41a1

PDB Entry: 1x41

PDB Description: solution structure of the myb-like dna binding domain of human transcriptional adaptor 2-like, isoform b

PDB Compounds: (A:) Transcriptional adaptor 2-like, isoform b

SCOP Domain Sequences for d1x41a1:

Sequence; same for both SEQRES and ATOM records:

>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]}
dpswtaqeemalleavmdcgfgnwqdvanqmctktkeecekhymkyf

Timeline for d1x41a1:

• d1x41a1 is new in SCOP 1.73
  
• d1x41a1 appears in SCOP 1.75
  
• d1x41a1 appears in the current release, SCOPe 2.08