Lineage for d1x41a1 (1x41 A:8-54)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981149Family a.4.1.1: Homeodomain [46690] (41 protein domains)
    Pfam PF00046
  6. 1981316Protein Transcriptional adaptor 2-like, TADA2L, isoform b [140145] (1 species)
  7. 1981317Species Human (Homo sapiens) [TaxId:9606] [140146] (1 PDB entry)
    Uniprot Q9BVJ0 72-118
  8. 1981318Domain d1x41a1: 1x41 A:8-54 [121676]
    Other proteins in same PDB: d1x41a2, d1x41a3

Details for d1x41a1

PDB Entry: 1x41 (more details)

PDB Description: Solution structure of the Myb-like DNA binding domain of human Transcriptional adaptor 2-like, isoform B
PDB Compounds: (A:) Transcriptional adaptor 2-like, isoform b

SCOPe Domain Sequences for d1x41a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]}
dpswtaqeemalleavmdcgfgnwqdvanqmctktkeecekhymkyf

SCOPe Domain Coordinates for d1x41a1:

Click to download the PDB-style file with coordinates for d1x41a1.
(The format of our PDB-style files is described here.)

Timeline for d1x41a1: