![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein Transcriptional adaptor 2-like, TADA2L, isoform b [140145] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140146] (1 PDB entry) Uniprot Q9BVJ0 72-118 |
![]() | Domain d1x41a1: 1x41 A:8-54 [121676] Other proteins in same PDB: d1x41a2, d1x41a3 |
PDB Entry: 1x41 (more details)
SCOPe Domain Sequences for d1x41a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} dpswtaqeemalleavmdcgfgnwqdvanqmctktkeecekhymkyf
Timeline for d1x41a1: