![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.189: XPC-binding domain [101237] (1 superfamily) 4 helices; array |
![]() | Superfamily a.189.1: XPC-binding domain [101238] (1 family) ![]() |
![]() | Family a.189.1.1: XPC-binding domain [101239] (4 proteins) |
![]() | Protein automated matches [190283] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188108] (1 PDB entry) |
![]() | Domain d1x3zb_: 1x3z B: [121674] Other proteins in same PDB: d1x3za_ automated match to d1x3wb1 complexed with suc, zn |
PDB Entry: 1x3z (more details), 2.8 Å
SCOPe Domain Sequences for d1x3zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3zb_ a.189.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gsigltvedllslrqvvsgnpealapllenisarypqlrehimanpevfvsmlleav
Timeline for d1x3zb_: