![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
![]() | Protein automated matches [190634] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188107] (1 PDB entry) |
![]() | Domain d1x3za_: 1x3z A: [121673] Other proteins in same PDB: d1x3zb_ automated match to d1x3wa1 complexed with suc, zn |
PDB Entry: 1x3z (more details), 2.8 Å
SCOPe Domain Sequences for d1x3za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3za_ d.3.1.4 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nnidfdsiakmllikykdfilskfkkaapvenirfqnlvhtnqfaqgvlgqsqhlctvyd npswhsivletldldliyknvdkefakdghaegeniytdylvkellryfkqdffkwcnkp dcnhcgqntsenmtplgsqgpngeeskfncgtveiykcnrcgnitrfpryndpiklletr kgrcgewcnlftlilksfgldvryvwnredhvwceyfsnflnrwvhvdsceqsfdqpyiy sinwnkkmsyciafgkdgvvdvskryilqnelprdqikeedlkflcqfitkrlryslndd eiyqlacrdeqeqielirgk
Timeline for d1x3za_: