Lineage for d1x3wa1 (1x3w A:8-327)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1192221Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 1192222Protein Peptide:N-glycanase 1, PNG1 [142852] (2 species)
  7. 1192223Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142853] (1 PDB entry)
    Uniprot Q02890 8-327
  8. 1192224Domain d1x3wa1: 1x3w A:8-327 [121671]
    Other proteins in same PDB: d1x3wb1
    complexed with suc, zn

Details for d1x3wa1

PDB Entry: 1x3w (more details), 3 Å

PDB Description: structure of a peptide:n-glycanase-rad23 complex
PDB Compounds: (A:) peptide:N-glycanase

SCOPe Domain Sequences for d1x3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3wa1 d.3.1.4 (A:8-327) Peptide:N-glycanase 1, PNG1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nnidfdsiakmllikykdfilskfkkaapvenirfqnlvhtnqfaqgvlgqsqhlctvyd
npswhsivletldldliyknvdkefakdghaegeniytdylvkellryfkqdffkwcnkp
dcnhcgqntsenmtplgsqgpngeeskfncgtveiykcnrcgnitrfpryndpiklletr
kgrcgewcnlftlilksfgldvryvwnredhvwceyfsnflnrwvhvdsceqsfdqpyiy
sinwnkkmsyciafgkdgvvdvskryilqnelprdqikeedlkflcqfitkrlryslndd
eiyqlacrdeqeqielirgk

SCOPe Domain Coordinates for d1x3wa1:

Click to download the PDB-style file with coordinates for d1x3wa1.
(The format of our PDB-style files is described here.)

Timeline for d1x3wa1: