SCOP 1.75: Domain d1x3wa1: 1x3w A:8-327

Lineage for d1x3wa1 (1x3w A:8-327)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.4: Transglutaminase core [54044] (2 proteins)

6. Protein Peptide:N-glycanase 1, PNG1 [142852] (2 species)

7. Species Baker's yeast(Saccharomyces cerevisiae) [TaxId:4932] [142853] (2 PDB entries)
   Uniprot Q02890 8-327

8. Domain d1x3wa1: 1x3w A:8-327 [121671]
   Other proteins in same PDB: d1x3wb1
   complexed with suc, zn

Details for d1x3wa1

PDB Entry: 1x3w, 3 Å

PDB Description: structure of a peptide:n-glycanase-rad23 complex

PDB Compounds: (A:) peptide:N-glycanase

SCOP Domain Sequences for d1x3wa1:

Sequence; same for both SEQRES and ATOM records:

>d1x3wa1 d.3.1.4 (A:8-327) Peptide:N-glycanase 1, PNG1 {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]}
nnidfdsiakmllikykdfilskfkkaapvenirfqnlvhtnqfaqgvlgqsqhlctvyd
npswhsivletldldliyknvdkefakdghaegeniytdylvkellryfkqdffkwcnkp
dcnhcgqntsenmtplgsqgpngeeskfncgtveiykcnrcgnitrfpryndpiklletr
kgrcgewcnlftlilksfgldvryvwnredhvwceyfsnflnrwvhvdsceqsfdqpyiy
sinwnkkmsyciafgkdgvvdvskryilqnelprdqikeedlkflcqfitkrlryslndd
eiyqlacrdeqeqielirgk

Timeline for d1x3wa1:

• d1x3wa1 first appeared in SCOP 1.73
  
• d1x3wa1 appears in SCOPe 2.01
  
• d1x3wa1 appears in the current release, SCOPe 2.08