Lineage for d1x3wa1 (1x3w A:8-327)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851268Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 851269Superfamily d.3.1: Cysteine proteinases [54001] (22 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 851591Family d.3.1.4: Transglutaminase core [54044] (2 proteins)
  6. 851592Protein Peptide:N-glycanase 1, PNG1 [142852] (2 species)
  7. 851593Species Baker's yeast(Saccharomyces cerevisiae) [TaxId:4932] [142853] (2 PDB entries)
    Uniprot Q02890 8-327
  8. 851595Domain d1x3wa1: 1x3w A:8-327 [121671]
    Other proteins in same PDB: d1x3wb1
    complexed with suc, zn

Details for d1x3wa1

PDB Entry: 1x3w (more details), 3 Å

PDB Description: structure of a peptide:n-glycanase-rad23 complex
PDB Compounds: (A:) peptide:N-glycanase

SCOP Domain Sequences for d1x3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3wa1 d.3.1.4 (A:8-327) Peptide:N-glycanase 1, PNG1 {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]}
nnidfdsiakmllikykdfilskfkkaapvenirfqnlvhtnqfaqgvlgqsqhlctvyd
npswhsivletldldliyknvdkefakdghaegeniytdylvkellryfkqdffkwcnkp
dcnhcgqntsenmtplgsqgpngeeskfncgtveiykcnrcgnitrfpryndpiklletr
kgrcgewcnlftlilksfgldvryvwnredhvwceyfsnflnrwvhvdsceqsfdqpyiy
sinwnkkmsyciafgkdgvvdvskryilqnelprdqikeedlkflcqfitkrlryslndd
eiyqlacrdeqeqielirgk

SCOP Domain Coordinates for d1x3wa1:

Click to download the PDB-style file with coordinates for d1x3wa1.
(The format of our PDB-style files is described here.)

Timeline for d1x3wa1: