![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab18 [142233] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142234] (1 PDB entry) Uniprot Q9NP72 2-178 |
![]() | Domain d1x3sa1: 1x3s A:2-178 [121670] complexed with gnp, mg |
PDB Entry: 1x3s (more details), 1.32 Å
SCOPe Domain Sequences for d1x3sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} dedvlttlkiliigesgvgksslllrftddtfdpelaatigvdfkvktisvdgnkaklai wdtagqerfrtltpsyyrgaqgvilvydvtrrdtfvkldnwlneletyctrndivnmlvg nkidkenrevdrneglkfarkhsmlfieasaktcdgvqcafeelvekiiqtpglwes
Timeline for d1x3sa1: