Lineage for d1x3sa1 (1x3s A:2-178)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696089Protein Rab18 [142233] (1 species)
  7. 696090Species Human (Homo sapiens) [TaxId:9606] [142234] (1 PDB entry)
  8. 696091Domain d1x3sa1: 1x3s A:2-178 [121670]
    complexed with gnp, mg

Details for d1x3sa1

PDB Entry: 1x3s (more details), 1.32 Å

PDB Description: Crystal structure of human Rab18 in complex with Gppnhp
PDB Compounds: (A:) Ras-related protein Rab-18

SCOP Domain Sequences for d1x3sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]}
dedvlttlkiliigesgvgksslllrftddtfdpelaatigvdfkvktisvdgnkaklai
wdtagqerfrtltpsyyrgaqgvilvydvtrrdtfvkldnwlneletyctrndivnmlvg
nkidkenrevdrneglkfarkhsmlfieasaktcdgvqcafeelvekiiqtpglwes

SCOP Domain Coordinates for d1x3sa1:

Click to download the PDB-style file with coordinates for d1x3sa1.
(The format of our PDB-style files is described here.)

Timeline for d1x3sa1: