Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab18 [142233] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142234] (1 PDB entry) |
Domain d1x3sa1: 1x3s A:2-178 [121670] complexed with gnp, mg |
PDB Entry: 1x3s (more details), 1.32 Å
SCOP Domain Sequences for d1x3sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} dedvlttlkiliigesgvgksslllrftddtfdpelaatigvdfkvktisvdgnkaklai wdtagqerfrtltpsyyrgaqgvilvydvtrrdtfvkldnwlneletyctrndivnmlvg nkidkenrevdrneglkfarkhsmlfieasaktcdgvqcafeelvekiiqtpglwes
Timeline for d1x3sa1: