Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Leupaxin [144175] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144176] (1 PDB entry) Uniprot O60711 260-295! Uniprot O60711 296-327 |
Domain d1x3ha1: 1x3h A:8-42 [121662] Other proteins in same PDB: d1x3ha3, d1x3ha4 complexed with zn |
PDB Entry: 1x3h (more details)
SCOPe Domain Sequences for d1x3ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} kdflamfspkcggcnrpvlenylsamdtvwhpecf
Timeline for d1x3ha1: