Lineage for d1x3ha1 (1x3h A:8-42)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640448Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 2640513Protein Leupaxin [144175] (1 species)
  7. 2640514Species Human (Homo sapiens) [TaxId:9606] [144176] (1 PDB entry)
    Uniprot O60711 260-295! Uniprot O60711 296-327
  8. 2640515Domain d1x3ha1: 1x3h A:8-42 [121662]
    Other proteins in same PDB: d1x3ha3, d1x3ha4
    complexed with zn

Details for d1x3ha1

PDB Entry: 1x3h (more details)

PDB Description: solution structure of the lim domain of human leupaxin
PDB Compounds: (A:) Leupaxin

SCOPe Domain Sequences for d1x3ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]}
kdflamfspkcggcnrpvlenylsamdtvwhpecf

SCOPe Domain Coordinates for d1x3ha1:

Click to download the PDB-style file with coordinates for d1x3ha1.
(The format of our PDB-style files is described here.)

Timeline for d1x3ha1: