Lineage for d1x3da1 (1x3d A:8-112)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2029371Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2029372Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2029557Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species)
  7. 2029558Species Human (Homo sapiens) [TaxId:9606] [117058] (6 PDB entries)
    Uniprot Q9Y2H6 192-315
  8. 2029559Domain d1x3da1: 1x3d A:8-112 [121661]
    Other proteins in same PDB: d1x3da2, d1x3da3

Details for d1x3da1

PDB Entry: 1x3d (more details)

PDB Description: Solution structure of the fibronectin type-III domain of human fibronectin type-III domain containing protein 3a
PDB Compounds: (A:) Fibronectin type-III domain containing protein 3a

SCOPe Domain Sequences for d1x3da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}
aeifttlscepdipnpprianrtknsltlqwkapsdngskiqnfvlewdegkgngefcqc
ymgsqkqfkitklspamgckfrlsarndygtsgfseevlyytsgc

SCOPe Domain Coordinates for d1x3da1:

Click to download the PDB-style file with coordinates for d1x3da1.
(The format of our PDB-style files is described here.)

Timeline for d1x3da1: