| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [117058] (6 PDB entries) Uniprot Q9Y2H6 192-315 |
| Domain d1x3da1: 1x3d A:8-112 [121661] Other proteins in same PDB: d1x3da2, d1x3da3 |
PDB Entry: 1x3d (more details)
SCOPe Domain Sequences for d1x3da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}
aeifttlscepdipnpprianrtknsltlqwkapsdngskiqnfvlewdegkgngefcqc
ymgsqkqfkitklspamgckfrlsarndygtsgfseevlyytsgc
Timeline for d1x3da1: