Lineage for d1x3ca1 (1x3c A:8-67)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639864Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 2639865Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 2639866Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 2640052Protein Zinc finger protein 292, ZNF292 [144133] (1 species)
  7. 2640053Species Human (Homo sapiens) [TaxId:9606] [144134] (1 PDB entry)
    Uniprot O60281 1340-1400
  8. 2640054Domain d1x3ca1: 1x3c A:8-67 [121660]
    Other proteins in same PDB: d1x3ca2, d1x3ca3
    complexed with zn

Details for d1x3ca1

PDB Entry: 1x3c (more details)

PDB Description: solution structure of the c2h2 type zinc-binding domain of human zinc finger protein 292
PDB Compounds: (A:) Zinc finger protein 292

SCOPe Domain Sequences for d1x3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3ca1 g.37.1.1 (A:8-67) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]}
rkkpvsqslefptryspyrpyrcvhqgcfaaftiqqnlilhyqavhksdlpafsaeveee

SCOPe Domain Coordinates for d1x3ca1:

Click to download the PDB-style file with coordinates for d1x3ca1.
(The format of our PDB-style files is described here.)

Timeline for d1x3ca1: