Class g: Small proteins [56992] (90 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins) |
Protein Zinc finger protein 292, ZNF292 [144133] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144134] (1 PDB entry) Uniprot O60281 1340-1400 |
Domain d1x3ca1: 1x3c A:8-68 [121660] complexed with zn |
PDB Entry: 1x3c (more details)
SCOP Domain Sequences for d1x3ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} rkkpvsqslefptryspyrpyrcvhqgcfaaftiqqnlilhyqavhksdlpafsaeveee s
Timeline for d1x3ca1: