Class g: Small proteins [56992] (85 folds) |
Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily) alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix |
Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (6 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins) |
Protein Zinc finger protein 292, ZNF292 [144133] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144134] (1 PDB entry) |
Domain d1x3ca1: 1x3c A:8-68 [121660] complexed with zn |
PDB Entry: 1x3c (more details)
SCOP Domain Sequences for d1x3ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} rkkpvsqslefptryspyrpyrcvhqgcfaaftiqqnlilhyqavhksdlpafsaeveee s
Timeline for d1x3ca1: