Lineage for d1x3ca1 (1x3c A:8-68)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749946Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
    alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix
  4. 749947Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (6 families) (S)
  5. 749948Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)
  6. 750125Protein Zinc finger protein 292, ZNF292 [144133] (1 species)
  7. 750126Species Human (Homo sapiens) [TaxId:9606] [144134] (1 PDB entry)
  8. 750127Domain d1x3ca1: 1x3c A:8-68 [121660]
    complexed with zn

Details for d1x3ca1

PDB Entry: 1x3c (more details)

PDB Description: solution structure of the c2h2 type zinc-binding domain of human zinc finger protein 292
PDB Compounds: (A:) Zinc finger protein 292

SCOP Domain Sequences for d1x3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]}
rkkpvsqslefptryspyrpyrcvhqgcfaaftiqqnlilhyqavhksdlpafsaeveee
s

SCOP Domain Coordinates for d1x3ca1:

Click to download the PDB-style file with coordinates for d1x3ca1.
(The format of our PDB-style files is described here.)

Timeline for d1x3ca1: